PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.20G234900.1.p
Common NameGLYMA_20G234900, LOC100791116
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 139aa    MW: 15604.7 Da    PI: 8.0622
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.20G234900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB153.15.2e-48699497
                NF-YB  4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                         qdr lPianv+rimk++lP  akisk+ k+++qecv+efisfvt+easdkc++e+rkt+ngdd++wal++lGf++y+e++  yl+ yr+ e+
  Glyma.20G234900.1.p  6 QDRALPIANVGRIMKQILPPSAKISKEGKQLMQECVTEFISFVTGEASDKCHKENRKTVNGDDICWALSSLGFDNYAEAIGRYLHIYRQGER 97
                         9****************************************************************************************999 PP

                NF-YB 96 ek 97
                         ek
  Glyma.20G234900.1.p 98 EK 99
                         86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.9E-464112IPR009072Histone-fold
SuperFamilySSF471132.1E-366110IPR009072Histone-fold
PfamPF008081.9E-25973IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.0E-163755No hitNo description
PROSITE patternPS0068504056IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.0E-165674No hitNo description
PRINTSPR006152.0E-167593No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MDQDVQDRAL PIANVGRIMK QILPPSAKIS KEGKQLMQEC VTEFISFVTG EASDKCHKEN  60
RKTVNGDDIC WALSSLGFDN YAEAIGRYLH IYRQGEREKI NHTKKYENPQ NQTQINRAPP  120
PPLLLSRVEN PPPTNQSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-40694492Transcription factor HapC (Eurofung)
4g92_B1e-40694492Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.256161e-149root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00133DAPTransfer from AT1G09030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2359141e-147AC235914.2 Glycine max clone GM_WBc0225O17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555607.11e-101PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO040271e-55NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLK7N5931e-101K7N593_SOYBN; Uncharacterized protein
STRINGGLYMA20G37870.21e-101(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.18e-57nuclear factor Y, subunit B4